PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA21G00036
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family bZIP
Protein Properties Length: 321aa    MW: 35913.6 Da    PI: 6.4283
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA21G00036genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_133.68.5e-11188231548
                 CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
      bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkke 48 
                 kr +r   NR +A+rsR RK+++i eLe+ v +L+ae + L  +
  AA21G00036 188 KRVKRILANRQSAQRSRVRKLQYISELERSVTSLQAEVSVLSPR 231
                 8999********************************98877655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.5E-13184248IPR004827Basic-leucine zipper domain
PfamPF077164.3E-9186233IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.622186238IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.65E-11188242No hitNo description
Gene3DG3DSA:1.20.5.1704.0E-13188239No hitNo description
CDDcd147032.26E-24189239No hitNo description
PROSITE patternPS000360191206IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009555Biological Processpollen development
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 321 aa     Download sequence    Send to blast
MAQLPPKIPT MPTPHWPDFS SQKPPSFSAV TAVTTAGAVT GQNPSWVDEF LDFSASRRGT  60
HRRSISDSIA FLEAPISSNN NHHFDRFDDE QFMSMFNDDD NKNNNNNVGP TTVSCSNTST  120
PSDHNSFNGD DNKEQKPPPS DQIESNKKNN NQESDEVQSH CKMEQEDGNT PSNNNSGDSS  180
GNRILDPKRV KRILANRQSA QRSRVRKLQY ISELERSVTS LQAEVSVLSP RVAFLDHQRL  240
LLNVDNSALK QRIAALAQDK VFKDAHQESL KREIERLRQV YNQQSLKKID NTNHSLVAGA  300
GVTPDIVDIK PIIETEQLLN V
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006411496.11e-154hypothetical protein EUTSA_v10016923mg
SwissprotF4IN231e-150BZP34_ARATH; Basic leucine zipper 34
TrEMBLV4M9C21e-154V4M9C2_EUTSA; Uncharacterized protein
STRINGAT2G42380.21e-148(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM17532777
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G58120.11e-137bZIP family protein